PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02705g02020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 532aa    MW: 58984.1 Da    PI: 7.3394
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02705g02020.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA49.46e-16741135
                      GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                              C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  Niben101Scf02705g02020.1  7 CYHCGVTSTPLWRNGPPEKPILCNACGSRWRTKGT 41
                              ****************66666***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.7E-10155IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.04E-11545No hitNo description
CDDcd002022.77E-16654No hitNo description
PfamPF003209.7E-14741IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.2E-12741IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PfamPF139198.4E-11273361IPR028020ASX homology domain
PfamPF165503.1E-9295370IPR032368UCH-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPILCN ACGSRWRTKG TLANYTPLHA RAEPDDFEDY  60
RVSRFKNSPV KNKEVKVLKR KKNHDNPEIG ILPDYNQGFH RKALDEDTSN RSSSGSAVSN  120
SESCAQFGSA EASDLTGPTQ SNIWEGMVPS KKRTCVGRPK QSSVEKLTKD LYTILHEQQC  180
SYCSGSSEED LLLESDKPMV SVEIGHGSVL IRHPSSLGRE EESEASSLSV DNKHHSSNEA  240
YSQLTTPPVH INKGVNSSNL VAERAKKPTG QDQIKRTKDQ LEKLQILGHH NSPLCHIDLK  300
DVLNYEEFIT HLSSDEQQQL LKYLPPVDSF SPPESLRSMF ESSQFEENLS SFQKLLAEGV  360
LDNSLSGVAV EDCRTLKRFT LCYLMKSKWV EQFNLLKDMK CKNSSSSSEV AGGPGVIGTD  420
HSGNMKRPRI GQRPKYSGAN TAMKSPKRVM LKSPYEQKEI IENDSSCFSP RSLFALPSEN  480
SFRFANESSD QDLLLDVPSN SSFPQAELLP TASFAAQAST SSSSVYPQLL RP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774753.10.0PREDICTED: GATA transcription factor 26-like
RefseqXP_016436475.10.0PREDICTED: GATA transcription factor 26-like
SwissprotQ8W4H11e-150GAT26_ARATH; GATA transcription factor 26
TrEMBLM1CHE60.0M1CHE6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000675060.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20892462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-136GATA transcription factor 26